Home / Peptide / Prime quality Sermorelin supplier from China

Prime quality Sermorelin supplier from China

Name Sermorelin
Cas No 86168-78-7(net),114466-38-5(acetate)
Tags:

Formula: C151H250N44O44S

Molecular:3417

Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSRQ

Purity:98%

Appearance: white powder

Source: synthetic

Diagnosing and treating growth hormone deficiency in children. It may also be used for other conditions as determined by your doctor.

Sermorelin acetate is a growth hormone-releasing agonist. It works by stimulating the pituitary gland to release growth hormone.

Sermorelin Acetate, also known as GRF 1-29, is a Growth Hormone Releasing Hormone (GHRH) produced by the brain that stimulates the production and release of Growth Hormone (GH). Sermorelin Acetate was first developed in the 70s, which is thought to be the shortest fully functional fragment of GHRH and has been used as a test for Growth Hormone secretion. It is often used extensively in Anti-aging Therapy  in men. Sermorelin Acetate affects a more primary source of failure in the GH neuroendocrine axis, has more physiological activity, and its use for adult hormone deficiency is not restricted. Compared to human Growth Hormone (hGH), Sermorelin Acetate is a growth hormone secretagogue, which means that it stimulates the pituitary gland to produce and secrete growth hormone. Also, Sermorelin Acetate and Modified GRF 1-29 contains 29 amino acids whereas hGH is a larger molecule containing 191 amino acids.


Product Description:

Sermorelin acetate (INN; brand names Geref, Gerel), also known as GHRH (1-29), is a peptide analogue of growth hormone-releasing hormone (GHRH) which is used as a diagnostic agent to assess growth hormone (GH) secretion for the purpose of diagnosing growth hormone deficiency. It is a 29-amino acid polypeptide representing the 1–29 fragment from endogenous human GHRH, thought to be the shortest fully functional fragment of GHRH. It belongs to an organic compound made from dehydrated amino acids, containing carboxyl groups and amino groups, is an amphoteric compound. 

Send your message to us